PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009104212.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 885aa    MW: 97817.2 Da    PI: 5.8052
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009104212.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.62.8e-29543593252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek++sl++l++yFs+++kdAAk+Lgvc+T+LKriCRq+GI+RWP+Rki+++
  XP_009104212.1 543 EKNVSLNVLQQYFSGSLKDAAKSLGVCPTTLKRICRQHGIMRWPSRKINKV 593
                     89***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.348528613IPR003035RWP-RK domain
PfamPF020422.8E-27545593IPR003035RWP-RK domain
SuperFamilySSF542773.14E-22774869No hitNo description
Gene3DG3DSA:3.10.20.2407.1E-22781863No hitNo description
SMARTSM006661.1E-23783866IPR000270PB1 domain
PROSITE profilePS5174520.362783866IPR000270PB1 domain
CDDcd064074.72E-34784865No hitNo description
PfamPF005646.0E-17785865IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 885 aa     Download sequence    Send to blast
MDNTSPDIPA EEMDGWVKNL ISEEDMFSSS SDLVNFESFA SWCNTPSASD ILFTQYGLTN  60
SQSTTPTPFG GFTALPAELS PSFHGLERCY VGEKRPVQEM SSQLHYLSGK RSKSSAIECS  120
VPRSLSYSLD EKMLKALSLF MEFSGEGILA QFWTPVKSGD HYMLSTCDQA YLLDSRLSGY  180
REVSRKYTFS AETSQYSSPG LPGRVFISGV PEWTSNVMYY KTAEYLRMKH ALDNDVRGSI  240
AIPVLQASGS SCCAVLELVT CREKPNFDLE MDSVCRALQA VNLQTSTIPR CQYVSSNQKE  300
ALSEIRDVLR AVCHAHRLPL ALAWIPCSYS KGTNNELVKV YGKKSDENSL LCIEESACYV  360
NDMDMECFVN ACMEHYLSKG QGVAGKAFVS NKPSFSSDVK TFDISEYPLV QHARKFGLNA  420
AVATKLRSTF TGDSDYILEF FLPVNMKGSS EQQLLLDSLS GTMQRICRTL RTVSDEVGLW  480
SGDRMLNLTQ STVTEGSFQT TLLDTDLNYT RSVFSSDIAG SHGTLQQETS GARRPERKKS  540
STEKNVSLNV LQQYFSGSLK DAAKSLGVCP TTLKRICRQH GIMRWPSRKI NKVNRSLRKI  600
QTVLDSVQGV EGGLKFDSAT GEFIAVGSLV QEFDTQKSLP CHHDDAFLKR QCDMDEDVSL  660
ELLKVKSHDG GKVKLEDSVE TNEARPAGSL MEPWVSKQSG LNYSDDFDIG TRSADVKKDK  720
DLGVRRCLSS LALAEPNPSI SSSMSDSSNG SGAVLVRSSS TSMEQDHNQT FRTHNSSSES  780
GSLLTVKATY RDDTIRFKLD PFVVGCSQLY KEVGKRFKLQ EGAFQLKYLD DDEEWVMLVT  840
DSDLQECLEI LNGMRKHTVK FLVRDIPGAA MGSSGGSNGY LGTGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892970.0AC189297.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB027O09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009104212.10.0PREDICTED: protein NLP9
SwissprotQ9M1B00.0NLP9_ARATH; Protein NLP9
TrEMBLM4CGP90.0M4CGP9_BRARP; Uncharacterized protein
STRINGBra003382.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22992768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.20.0Nin-like family protein